Recombinant Full Length Human TFRC Protein, C-Flag-tagged
Cat.No. : | TFRC-466HFL |
Product Overview : | Recombinant Full Length Human TFRC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 84.7 kDa |
AA Sequence : | MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane |
Protein Pathways : | Endocytosis, Hematopoietic cell lineage |
Full Length : | Full L. |
Gene Name | TFRC transferrin receptor [ Homo sapiens (human) ] |
Official Symbol | TFRC |
Synonyms | T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 |
Gene ID | 7037 |
mRNA Refseq | NM_001128148.3 |
Protein Refseq | NP_001121620.1 |
MIM | 190010 |
UniProt ID | P02786 |
◆ Recombinant Proteins | ||
Tfrc-1569R | Recombinant Rat Tfrc protein, His-tagged | +Inquiry |
TFRC-2620H | Active Recombinant Human TFRC protein, His-tagged | +Inquiry |
TFRC-5128H | Recombinant Human TFRC Protein (Cys89-Phe760), N-His tagged | +Inquiry |
TFRC-1564H | Recombinant Horse TFRC protein, His & GST-tagged | +Inquiry |
TFRC-791H | Recombinant Human TFRC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TFRC-69H | Native Human Apotransferrin | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFRC-1813MCL | Recombinant Mouse TFRC cell lysate | +Inquiry |
TFRC-950CCL | Recombinant Cynomolgus TFRC cell lysate | +Inquiry |
TFRC-2058HCL | Recombinant Human TFRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFRC Products
Required fields are marked with *
My Review for All TFRC Products
Required fields are marked with *
0
Inquiry Basket