Recombinant Full Length Human Tetraspanin-32(Tspan32) Protein, His-Tagged
Cat.No. : | RFL29278HF |
Product Overview : | Recombinant Full Length Human Tetraspanin-32(TSPAN32) Protein (Q96QS1) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN32 |
Synonyms | TSPAN32; PHEMX; TSSC6; Tetraspanin-32; Tspan-32; Protein Phemx |
UniProt ID | Q96QS1 |
◆ Recombinant Proteins | ||
MRAP-5662M | Recombinant Mouse MRAP Protein, His (Fc)-Avi-tagged | +Inquiry |
RPP25L-663Z | Recombinant Zebrafish RPP25L | +Inquiry |
RFL-25287MF | Recombinant Full Length Mouse Alpha-1A Adrenergic Receptor(Adra1A) Protein, His-Tagged | +Inquiry |
Casp1-7151M | Recombinant Mouse Casp1 protein, His-tagged | +Inquiry |
ARL10-9848H | Recombinant Human ARL10, His-tagged | +Inquiry |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1L1-6866HCL | Recombinant Human DNASE1L1 293 Cell Lysate | +Inquiry |
RPLP0-2184HCL | Recombinant Human RPLP0 293 Cell Lysate | +Inquiry |
ACSBG1-9079HCL | Recombinant Human ACSBG1 293 Cell Lysate | +Inquiry |
ZMAT4-156HCL | Recombinant Human ZMAT4 293 Cell Lysate | +Inquiry |
UIMC1-506HCL | Recombinant Human UIMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSPAN32 Products
Required fields are marked with *
My Review for All TSPAN32 Products
Required fields are marked with *
0
Inquiry Basket