Recombinant Full Length Human TBC1D22A-AS1 Protein, GST-tagged

• Cat.No.: TBC1D22A-AS1-5011HF
• Product Overview: Human FLJ32756 full-length ORF ( CAK54515.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 177 amino acids
• Description: TBC1D22A-AS1 (TBC1D22A Antisense RNA 1) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 45.87 kDa
• AA Sequence: MSHSRRAAPTQDQCHTPGFPTSRETSGSIWQARICGSLQALDTWRTHIPRKSPAPTQASQICLLLPESPWRNPTPRGFLKPLINWDAILYFKEKRNIQVTTQAHPQNQASCSSQEVATPGLVPQAAAPKVYERSHDNLNAEAQGLAGAQVSKPQNPITRLCSLKEQSILKIFTKQSI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TBC1D22A-AS1 TBC1D22A antisense RNA 1 [ Homo sapiens (human) ]
• Official Symbol: TBC1D22A-AS1
• Synonyms: TBC1D22A-AS1; TBC1D22A antisense RNA 1
• Gene ID: 642757