Recombinant Full Length Human TBC1D22A-AS1 Protein, GST-tagged
Cat.No. : | TBC1D22A-AS1-5011HF |
Product Overview : | Human FLJ32756 full-length ORF ( CAK54515.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 177 amino acids |
Description : | TBC1D22A-AS1 (TBC1D22A Antisense RNA 1) is an RNA Gene, and is affiliated with the non-coding RNA class. |
Molecular Mass : | 45.87 kDa |
AA Sequence : | MSHSRRAAPTQDQCHTPGFPTSRETSGSIWQARICGSLQALDTWRTHIPRKSPAPTQASQICLLLPESPWRNPTPRGFLKPLINWDAILYFKEKRNIQVTTQAHPQNQASCSSQEVATPGLVPQAAAPKVYERSHDNLNAEAQGLAGAQVSKPQNPITRLCSLKEQSILKIFTKQSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TBC1D22A-AS1 TBC1D22A antisense RNA 1 [ Homo sapiens (human) ] |
Official Symbol | TBC1D22A-AS1 |
Synonyms | TBC1D22A-AS1; TBC1D22A antisense RNA 1 |
Gene ID | 642757 |
◆ Recombinant Proteins | ||
TBC1D22A-AS1-5011HF | Recombinant Full Length Human TBC1D22A-AS1 Protein, GST-tagged | +Inquiry |
TBC1D22A-AS1-AS1 | Recombinant Human TBC1D22A-AS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBC1D22A-AS1 Products
Required fields are marked with *
My Review for All TBC1D22A-AS1 Products
Required fields are marked with *
0
Inquiry Basket