Recombinant Full Length Human TAT Protein, C-Flag-tagged

• Cat.No.: TAT-999HFL
• Product Overview: Recombinant Full Length Human TAT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible cognitive disability. A regulator gene for tyrosine aminotransferase is X-linked.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 50.2 kDa
• AA Sequence: MDPYMIQMSSKGNLSSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPN KTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEAPLEAKDVIL TSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTA CLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAK RWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNA DLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVI
  TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylalanine metabolism, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis
• Full Length: Full L.

Gene Information

• Gene Name: TAT tyrosine aminotransferase [ Homo sapiens (human) ]
• Official Symbol: TAT
• Synonyms: tyrosine aminotransferase; tyrosine aminotransferase, cytosolic
• Gene ID: 6898
• mRNA Refseq: NM_000353.3
• Protein Refseq: NP_000344.1
• MIM: 613018
• UniProt ID: P17735