Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Zeta Chain(Cd247) Protein, His-Tagged
Cat.No. : | RFL24008HF |
Product Overview : | Recombinant Full Length Human T-cell surface glycoprotein CD3 zeta chain(CD247) Protein (P20963) (22-164aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-164) |
Form : | Lyophilized powder |
AA Sequence : | QSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD247 |
Synonyms | CD247; CD3Z; T3Z; TCRZ; T-cell surface glycoprotein CD3 zeta chain; T-cell receptor T3 zeta chain; CD antigen CD247 |
UniProt ID | P20963 |
◆ Recombinant Proteins | ||
CD247-3088HF | Recombinant Full Length Human CD247 Protein, GST-tagged | +Inquiry |
CD247-730R | Recombinant Rhesus monkey CD247 Protein, His-tagged | +Inquiry |
CD247-2726H | Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD247-151H | Recombinant Human CD247 Protein, His-tagged | +Inquiry |
CD247-1446M | Recombinant Mouse CD247 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *
0
Inquiry Basket