Recombinant Full Length Human SYAP1 Protein, C-Flag-tagged

• Cat.No.: SYAP1-1701HFL
• Product Overview: Recombinant Full Length Human SYAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Involved in several processes, including TORC2 signaling; cellular response to growth factor stimulus; and cellular response to peptide hormone stimulus. Located in Golgi apparatus; cytosol; and nucleoplasm. Is extrinsic component of cytoplasmic side of plasma membrane.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 39.8 kDa
• AA Sequence: MFRGLSSWLGLQQPVAGGGQPNGDALPEQPSETVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATK KITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTNDEETIQQQI LALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRVSLIK QSAQLTALAAQQQAAGKEEKSNGREQDLPLAEAVRPKTPPVVIKSQLKTQEDEEEISTSPGVSEFVSDAF DACNLNQEDLRKEMEQLVLDKKQEETAVLEEDSADWEKELQQELQEYEVVTESEKRDENWDKEIEKMLQE
  ENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: SYAP1 synapse associated protein 1 [ Homo sapiens (human) ]
• Official Symbol: SYAP1
• Synonyms: BSTA; PRO3113
• Gene ID: 94056
• mRNA Refseq: NM_032796.4
• Protein Refseq: NP_116185.2
• UniProt ID: Q96A49