Recombinant Full Length Human SUB1 Protein, C-Flag-tagged

• Cat.No.: SUB1-2181HFL
• Product Overview: Recombinant Full Length Human SUB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables identical protein binding activity; single-stranded DNA binding activity; and transcription coactivator activity. Involved in negative regulation of DNA metabolic process and regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of transcription regulator complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14.2 kDa
• AA Sequence: MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transcription Factors
• Full Length: Full L.

Gene Information

• Gene Name: SUB1 SUB1 regulator of transcription [ Homo sapiens (human) ]
• Official Symbol: SUB1
• Synonyms: P15; PC4; p14
• Gene ID: 10923
• mRNA Refseq: NM_006713.4
• Protein Refseq: NP_006704.3
• MIM: 600503
• UniProt ID: P53999