Recombinant Full Length Human SRSF3 Protein
Cat.No. : | SRSF3-497HF |
Product Overview : | Recombinant full length Human SFRS3 with N terminal proprietary tag; Predicted MWt 44.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 164 amino acids |
Description : | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 44.110kDa inclusive of tags |
AA Sequence : | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVW VARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVEL SNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRS NERK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ] |
Official Symbol | SRSF3 |
Synonyms | SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20 |
Gene ID | 6428 |
mRNA Refseq | NM_003017 |
Protein Refseq | NP_003008 |
MIM | 603364 |
UniProt ID | P84103 |
◆ Recombinant Proteins | ||
SRSF3-26854TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-4573H | Recombinant Human SRSF3 protein, His-GB1-tagged | +Inquiry |
SRSF3-4142C | Recombinant Chicken SRSF3 | +Inquiry |
SRSF3-26855TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-497HF | Recombinant Full Length Human SRSF3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF3-1904HCL | Recombinant Human SFRS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRSF3 Products
Required fields are marked with *
My Review for All SRSF3 Products
Required fields are marked with *
0
Inquiry Basket