Recombinant Full Length Human SPTSSB Protein, GST-tagged

• Cat.No.: SPTSSB-3892HF
• Product Overview: Human C3orf57 full-length ORF (BAG35080.1, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 76 amino acids
• Description: Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
• Molecular Mass: 34.76 kDa
• AA Sequence: MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPTSSB serine palmitoyltransferase small subunit B [ Homo sapiens (human) ]
• Official Symbol: SPTSSB
• Synonyms: SPTSSB; serine palmitoyltransferase small subunit B; Serine Palmitoyltransferase Small Subunit B; Small Subunit Of Serine Palmitoyltransferase B; Androgen Down Regulated In Mouse Prostate; C3orf57; SSSPTB; ADMP; Likely Ortholog Of Androgen Down Regulated Gene Expressed In Mouse Prostate; Serine Palmitoyltransferase, Small Subunit B; Chromosome 3 Open Reading Frame 57; Protein ADMP; serine palmitoyltransferase small subunit B; androgen down regulated in mouse prostate; likely ortholog of androgen down regulated gene expressed in mouse prostate; small subunit of serine palmitoyltransferase B
• Gene ID: 165679
• mRNA Refseq: NM_001040100
• Protein Refseq: NP_001035189
• MIM: 610412
• UniProt ID: Q8NFR3