Recombinant Full Length Human Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged
Cat.No. : | RFL22921HF |
Product Overview : | Recombinant Full Length Human Serine palmitoyltransferase small subunit B(SPTSSB) Protein (Q8NFR3) (1-76aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-76) |
Form : | Lyophilized powder |
AA Sequence : | MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLA WEFFSKICGYHSTISN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPTSSB |
Synonyms | SPTSSB; ADMP; C3orf57; SSSPTB; Serine palmitoyltransferase small subunit B; Protein ADMP; Small subunit of serine palmitoyltransferase B; ssSPTb |
UniProt ID | Q8NFR3 |
◆ Recombinant Proteins | ||
SPTSSB-4458R | Recombinant Rhesus monkey SPTSSB Protein, His-tagged | +Inquiry |
SPTSSB-4274R | Recombinant Rhesus Macaque SPTSSB Protein, His (Fc)-Avi-tagged | +Inquiry |
SPTSSB-15959M | Recombinant Mouse SPTSSB Protein | +Inquiry |
Sptssb-6118M | Recombinant Mouse Sptssb Protein, Myc/DDK-tagged | +Inquiry |
RFL15463MF | Recombinant Full Length Mouse Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTSSB-8041HCL | Recombinant Human C3orf57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPTSSB Products
Required fields are marked with *
My Review for All SPTSSB Products
Required fields are marked with *
0
Inquiry Basket