Recombinant Full Length Human SPRR3 Protein
Cat.No. : | SPRR3-493HF |
Product Overview : | Recombinant full length Human SPRR3 with N terminal proprietary tag; Predicted MWt 43.82 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 161 amino acids |
Description : | Small proline-rich protein 3 is a protein that in humans is encoded by the SPRR3 gene. |
Form : | Liquid |
Molecular Mass : | 43.820kDa inclusive of tags |
AA Sequence : | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEP CHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEP GAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQ K |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SPRR3 small proline-rich protein 3 [ Homo sapiens ] |
Official Symbol | SPRR3 |
Synonyms | SPRR3; small proline-rich protein 3 |
Gene ID | 6707 |
mRNA Refseq | NM_001097589 |
Protein Refseq | NP_001091058 |
MIM | 182271 |
UniProt ID | Q9UBC9 |
◆ Recombinant Proteins | ||
SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry |
SPRR3-493HF | Recombinant Full Length Human SPRR3 Protein | +Inquiry |
SPRR3-29265TH | Recombinant Human SPRR3 | +Inquiry |
SPRR3-3523H | Recombinant Human SPRR3 protein, His-SUMO-tagged | +Inquiry |
SPRR3-15940M | Recombinant Mouse SPRR3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRR3 Products
Required fields are marked with *
My Review for All SPRR3 Products
Required fields are marked with *
0
Inquiry Basket