Recombinant Full Length Human SOX18 Protein, C-Flag-tagged
Cat.No. : | SOX18-1480HFL |
Product Overview : | Recombinant Full Length Human SOX18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLS PAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAER LRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFPAASGSARAFRELPPLGAEFDGL GLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLA GLYYGTLGTPGPYPGPLSPPPEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALA KLGPRAMSCPEESSLISALSDASSAVYYSACISGSGPSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Transcription Factors |
Full Length : | Full L. |
Gene Name | SOX18 SRY-box transcription factor 18 [ Homo sapiens (human) ] |
Official Symbol | SOX18 |
Synonyms | HLTS; HLTRS |
Gene ID | 54345 |
mRNA Refseq | NM_018419.3 |
Protein Refseq | NP_060889.1 |
MIM | 601618 |
UniProt ID | P35713 |
◆ Recombinant Proteins | ||
SOX18-5882C | Recombinant Chicken SOX18 | +Inquiry |
Sox18-6053M | Recombinant Mouse Sox18 Protein, Myc/DDK-tagged | +Inquiry |
SOX18-1480HFL | Recombinant Full Length Human SOX18 Protein, C-Flag-tagged | +Inquiry |
SOX18-2511H | Recombinant Human SOX18 Protein, MYC/DDK-tagged | +Inquiry |
SOX18-2075H | Recombinant Human SOX18 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX18 Products
Required fields are marked with *
My Review for All SOX18 Products
Required fields are marked with *
0
Inquiry Basket