Recombinant Full Length Human Somatostatin Receptor Type 5(Sstr5) Protein, His-Tagged
Cat.No. : | RFL17100HF |
Product Overview : | Recombinant Full Length Human Somatostatin receptor type 5(SSTR5) Protein (P35346) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ TSKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SSTR5 |
Synonyms | SSTR5; Somatostatin receptor type 5; SS-5-R; SS5-R; SS5R |
UniProt ID | P35346 |
◆ Recombinant Proteins | ||
SSTR5-8754M | Recombinant Mouse SSTR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSTR5-16046M | Recombinant Mouse SSTR5 Protein | +Inquiry |
RFL33347MF | Recombinant Full Length Mouse Somatostatin Receptor Type 5(Sstr5) Protein, His-Tagged | +Inquiry |
SSTR5-2972H | Recombinant Human SSTR5, GST-tagged | +Inquiry |
SSTR5-2204C | Recombinant Chicken SSTR5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSTR5-1699HCL | Recombinant Human SSTR5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSTR5 Products
Required fields are marked with *
My Review for All SSTR5 Products
Required fields are marked with *
0
Inquiry Basket