Recombinant Full Length Human SNX18 Protein, C-Flag-tagged
Cat.No. : | SNX18-1139HFL |
Product Overview : | Recombinant Full Length Human SNX18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 68.8 kDa |
AA Sequence : | MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIRAPEPGPAGDG GPGAPARYANVPPGGFEPLPVAPPASFKPPPDAFQALLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQL YGGYQASQGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSV PPQHHPSGPKSSATVSRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTI DDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFIS KRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD LQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLN QAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEV QKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKYDSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SNX18 sorting nexin 18 [ Homo sapiens (human) ] |
Official Symbol | SNX18 |
Synonyms | SNAG1; SH3PX2; SH3PXD3B |
Gene ID | 112574 |
mRNA Refseq | NM_001102575.2 |
Protein Refseq | NP_001096045.1 |
UniProt ID | Q96RF0 |
◆ Recombinant Proteins | ||
Snx18-8115M | Recombinant Mouse Snx18 protein, His & T7-tagged | +Inquiry |
SNX18-2065H | Recombinant Human SNX18 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX18-4208R | Recombinant Rhesus Macaque SNX18 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX18-4392R | Recombinant Rhesus monkey SNX18 Protein, His-tagged | +Inquiry |
SNX18-2859H | Recombinant Human SNX18, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX18-1595HCL | Recombinant Human SNX18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX18 Products
Required fields are marked with *
My Review for All SNX18 Products
Required fields are marked with *
0
Inquiry Basket