Recombinant Full Length Human SNX15 Protein, C-Flag-tagged
Cat.No. : | SNX15-2090HFL |
Product Overview : | Recombinant Full Length Human SNX15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. Overexpression of this gene results in a decrease in the processing of insulin and hepatocyte growth factor receptors to their mature subunits. This decrease is caused by the mislocalization of furin, the endoprotease responsible for cleavage of insulin and hepatocyte growth factor receptors. This protein is involved in endosomal trafficking from the plasma membrane to recycling endosomes or the trans-Golgi network. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ADP-ribosylation factor-like 2 (ARL2) gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLF RRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLHI LPPPLIPTPPPDDPRLSQLLPAERRGLEELEVPVDPPPSSPAQEALDLLFNCESTEEASGSPARGPLTEA ELALFDPFSKEEGAAPSPTHVAELATMEVESARLDQEPWEPGGQEEEEDGEGGPTPAYLSQATELITQAL RDEKAGAYAAALQGYRDGVHVLLQGVPSDPLPARQEGVKKKAAEYLKRAEEILRLHLSQLPP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SNX15 sorting nexin 15 [ Homo sapiens (human) ] |
Official Symbol | SNX15 |
Synonyms | HSAF001435 |
Gene ID | 29907 |
mRNA Refseq | NM_013306.5 |
Protein Refseq | NP_037438.2 |
MIM | 605964 |
UniProt ID | Q9NRS6 |
◆ Recombinant Proteins | ||
SNX15-2064H | Recombinant Human SNX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX15-2090HFL | Recombinant Full Length Human SNX15 Protein, C-Flag-tagged | +Inquiry |
SNX15-8547M | Recombinant Mouse SNX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX15-2417H | Recombinant Human SNX15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNX15-15717M | Recombinant Mouse SNX15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX15-1660HCL | Recombinant Human SNX15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX15 Products
Required fields are marked with *
My Review for All SNX15 Products
Required fields are marked with *
0
Inquiry Basket