Recombinant Full Length Human SNRPC Protein

Cat.No. : SNRPC-486HF
Product Overview : Recombinant full length Human SNRPC with N-terminal proprietary tag. Predicted MW 43.56 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 159 amino acids
Description : This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.
Form : Liquid
Molecular Mass : 43.560kDa inclusive of tags
AA Sequence : MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQK WMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP PSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens ]
Official Symbol SNRPC
Synonyms SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1
Gene ID 6631
mRNA Refseq NM_003093
Protein Refseq NP_003084
MIM 603522
UniProt ID P09234

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNRPC Products

Required fields are marked with *

My Review for All SNRPC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon