Recombinant Full Length Human SLC25A36 Protein, GST-tagged

• Cat.No.: SLC25A36-4841HF
• Product Overview: Human FLJ10618 full-length ORF ( AAH14064, 1 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SLC25A36 (Solute Carrier Family 25 Member 36) is a Protein Coding gene. GO annotations related to this gene include pyrimidine nucleotide transmembrane transporter activity. An important paralog of this gene is SLC25A33.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 59.95 kDa
• Protein length: 311 amino acids
• AA Sequence: MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLC25A36 solute carrier family 25 (pyrimidine nucleotide carrier ), member 36 [ Homo sapiens ]
• Official Symbol: SLC25A36
• Synonyms: SLC25A36; solute carrier family 25 (pyrimidine nucleotide carrier ), member 36; solute carrier family 25, member 36; solute carrier family 25 member 36; FLJ10618; PNC2; DKFZp564C053
• Gene ID: 55186
• mRNA Refseq: NM_001104647
• Protein Refseq: NP_001098117
• MIM: 616149
• UniProt ID: Q96CQ1