Recombinant Full Length Human SLC16A1 Protein, C-Flag-tagged
Cat.No. : | SLC16A1-953HFL |
Product Overview : | Recombinant Full Length Human SLC16A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate transporter defect. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD GGPKEEESPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | SLC16A1 solute carrier family 16 member 1 [ Homo sapiens (human) ] |
Official Symbol | SLC16A1 |
Synonyms | MCT; HHF7; MCT1; MCT1D |
Gene ID | 6566 |
mRNA Refseq | NM_003051.4 |
Protein Refseq | NP_003042.3 |
MIM | 600682 |
UniProt ID | P53985 |
◆ Recombinant Proteins | ||
RFL15926MF | Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 1(Slc16A1) Protein, His-Tagged | +Inquiry |
SLC16A1-8227M | Recombinant Mouse SLC16A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC16A1-54H | Recombinant Human SLC16A1 Protein, GST-tagged | +Inquiry |
SLC16A1-6788HF | Recombinant Full Length Human SLC16A1 Protein, GST-tagged | +Inquiry |
SLC16A1-6558H | Recombinant Human SLC16A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC16A1 Products
Required fields are marked with *
My Review for All SLC16A1 Products
Required fields are marked with *
0
Inquiry Basket