Recombinant Full Length Human SFR1 Protein, GST-tagged

• Cat.No.: SFR1-1741HF
• Product Overview: Human C10orf78 full-length ORF ( NP_001002759.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 245 amino acids
• Description: Enables nuclear receptor coactivator activity. Involved in cellular response to estrogen stimulus; double-strand break repair via homologous recombination; and positive regulation of transcription, DNA-templated. Located in nucleus. Part of Swi5-Sfr1 complex.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 54.7 kDa
• AA Sequence: MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SFR1 SWI5-dependent recombination repair 1 [ Homo sapiens ]
• Official Symbol: SFR1
• Synonyms: SFR1; SWI5-dependent recombination repair 1; C10orf78, chromosome 10 open reading frame 78 , MEI5 recombination repair protein homolog (S. cerevisiae) , MEIR5; swi5-dependent recombination DNA repair protein 1 homolog; bA373N18.1; FLJ41960; MEI5; meiosis protein 5 homolog; MEI5 recombination repair protein homolog; SWI5-dependent recombination repair protein 1; MEIR5; C10orf78; RP11-373N18.1
• Gene ID: 119392
• mRNA Refseq: NM_001002759
• Protein Refseq: NP_001002759
• MIM: 616527
• UniProt ID: Q86XK3