Recombinant Full Length Human SFN Protein, C-Flag-tagged

• Cat.No.: SFN-942HFL
• Product Overview: Recombinant Full Length Human SFN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 27.6 kDa
• AA Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE
  DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cell cycle, p53 signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: SFN stratifin [ Homo sapiens (human) ]
• Official Symbol: SFN
• Synonyms: YWHAS
• Gene ID: 2810
• mRNA Refseq: NM_006142.5
• Protein Refseq: NP_006133.1
• MIM: 601290
• UniProt ID: P31947