Recombinant Full Length Human SESN2 Protein, C-Flag-tagged
Cat.No. : | SESN2-1376HFL |
Product Overview : | Recombinant Full Length Human SESN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.3 kDa |
AA Sequence : | MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEAL MSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTG GDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSF VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQ EEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | p53 signaling pathway |
Full Length : | Full L. |
Gene Name | SESN2 sestrin 2 [ Homo sapiens (human) ] |
Official Symbol | SESN2 |
Synonyms | HI95; SES2; SEST2 |
Gene ID | 83667 |
mRNA Refseq | NM_031459.5 |
Protein Refseq | NP_113647.1 |
MIM | 607767 |
UniProt ID | P58004 |
◆ Recombinant Proteins | ||
SESN2-4160R | Recombinant Rhesus monkey SESN2 Protein, His-tagged | +Inquiry |
SESN2-1376HFL | Recombinant Full Length Human SESN2 Protein, C-Flag-tagged | +Inquiry |
SESN2-2606H | Recombinant Human SESN2, GST-tagged | +Inquiry |
SESN2-6245H | Recombinant Human SESN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SESN2-4932Z | Recombinant Zebrafish SESN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SESN2-1930HCL | Recombinant Human SESN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SESN2 Products
Required fields are marked with *
My Review for All SESN2 Products
Required fields are marked with *
0
Inquiry Basket