Recombinant Full Length Human SERTM1 Protein, GST-tagged

• Cat.No.: SERTM1-1781HF
• Product Overview: Human C13orf36 full-length ORF (AAH36540.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Located in intracellular membrane-bounded organelle.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.17 kDa
• Protein length: 107 amino acids
• AA Sequence: MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNIISSSSSYPGYPSDAGSSFTNLEVCSISSQRSTFSNLSS
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SERTM1 serine-rich and transmembrane domain containing 1 [ Homo sapiens ]
• Official Symbol: SERTM1
• Synonyms: SERTM1; serine-rich and transmembrane domain containing 1; C13orf36, chromosome 13 open reading frame 36; serine-rich and transmembrane domain-containing protein 1; serine-rich and transmembrane domain-containing 1; C13orf36; RP11-16L6.1; MGC33996
• Gene ID: 400120
• mRNA Refseq: NM_203451
• Protein Refseq: NP_982276
• UniProt ID: A2A2V5