Recombinant Full Length Human SERPINB9 Protein, C-Flag-tagged
Cat.No. : | SERPINB9-1177HFL |
Product Overview : | Recombinant Full Length Human SERPINB9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC ADHPFLFFIRHNRANSILFCGRFSSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | SERPINB9 serpin family B member 9 [ Homo sapiens (human) ] |
Official Symbol | SERPINB9 |
Synonyms | PI9; CAP3; PI-9; CAP-3 |
Gene ID | 5272 |
mRNA Refseq | NM_004155.6 |
Protein Refseq | NP_004146.1 |
MIM | 601799 |
UniProt ID | P50453 |
◆ Recombinant Proteins | ||
SERPINB9-1006H | Recombinant Human SERPINB9 Protein, MYC/DDK-tagged | +Inquiry |
SERPINB9-8643H | Recombinant Human SERPINB9 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
SERPINB9-301615H | Recombinant Human SERPINB9 protein, GST-tagged | +Inquiry |
SERPINB9-5916H | Recombinant Human SERPINB9 Protein (Met1-Pro376), C-His tagged | +Inquiry |
SERPINB9-3302H | Recombinant Human SERPINB9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB9-562HCL | Recombinant Human SERPINB9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB9 Products
Required fields are marked with *
My Review for All SERPINB9 Products
Required fields are marked with *
0
Inquiry Basket