Recombinant Full Length Human SERBP1 Protein, C-Flag-tagged
Cat.No. : | SERBP1-526HFL |
Product Overview : | Recombinant Full Length Human SERBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables SUMO binding activity; mRNA 3'-UTR binding activity; and ribosome binding activity. Involved in PML body organization. Located in cytosol and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SERBP1 SERPINE1 mRNA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | SERBP1 |
Synonyms | CGI-55; CHD3IP; HABP4L; PAIRBP1; PAI-RBP1 |
Gene ID | 26135 |
mRNA Refseq | NM_001018067.2 |
Protein Refseq | NP_001018077.1 |
MIM | 607378 |
UniProt ID | Q8NC51 |
◆ Recombinant Proteins | ||
SERBP1-1030H | Recombinant Human SERBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERBP1-2078H | Recombinant Human SERBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERBP1-4989R | Recombinant Rat SERBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERBP1-526HFL | Recombinant Full Length Human SERBP1 Protein, C-Flag-tagged | +Inquiry |
SERBP1-2949C | Recombinant Chicken SERBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERBP1-1949HCL | Recombinant Human SERBP1 293 Cell Lysate | +Inquiry |
SERBP1-1950HCL | Recombinant Human SERBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERBP1 Products
Required fields are marked with *
My Review for All SERBP1 Products
Required fields are marked with *
0
Inquiry Basket