Recombinant Full Length Human SELENBP1 Protein, C-Flag-tagged
Cat.No. : | SELENBP1-2066HFL |
Product Overview : | Recombinant Full Length Human SELENBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. The effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins, and decreased expression of this gene may be associated with several types of cancer. The encoded protein may play a selenium-dependent role in ubiquitination/deubiquitination-mediated protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.2 kDa |
AA Sequence : | MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKD ELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSH CLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVL RDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKN EGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLF LGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SELENBP1 selenium binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | SELENBP1 |
Synonyms | MTO; LPSB; SP56; hSBP; EHMTO; SBP56; HEL-S-134P |
Gene ID | 8991 |
mRNA Refseq | NM_003944.4 |
Protein Refseq | NP_003935.2 |
MIM | 604188 |
UniProt ID | Q13228 |
◆ Recombinant Proteins | ||
SELENBP1-7997M | Recombinant Mouse SELENBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SELENBP1-4967R | Recombinant Rat SELENBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SELENBP1-5308R | Recombinant Rat SELENBP1 Protein | +Inquiry |
SELENBP1-1967H | Recombinant Human SELENBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SELENBP1-453H | Recombinant Human SELENBP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELENBP1-1984HCL | Recombinant Human SELENBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SELENBP1 Products
Required fields are marked with *
My Review for All SELENBP1 Products
Required fields are marked with *
0
Inquiry Basket