Recombinant Full Length Human SCN2B Protein
Cat.No. : | SCN2B-457HF |
Product Overview : | Recombinant full length Human Scn2b with N terminal proprietary tag; Predicted MWt 49.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 215 amino acids |
Description : | Sodium channel subunit beta-2 is a protein that in humans is encoded by the SCN2B gene. |
Form : | Liquid |
Molecular Mass : | 49.760kDa inclusive of tags |
AA Sequence : | MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNV LNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMF LQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV IVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SCN2B sodium channel, voltage-gated, type II, beta [ Homo sapiens ] |
Official Symbol | SCN2B |
Synonyms | SCN2B; sodium channel, voltage-gated, type II, beta; sodium channel, voltage gated, type II, beta polypeptide; sodium channel subunit beta-2 |
Gene ID | 6327 |
mRNA Refseq | NM_004588 |
Protein Refseq | NP_004579 |
MIM | 601327 |
UniProt ID | O60939 |
◆ Recombinant Proteins | ||
SCN2B-31351TH | Recombinant Human SCN2B | +Inquiry |
SCN2B-3917R | Recombinant Rhesus Macaque SCN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN2B-4815Z | Recombinant Zebrafish SCN2B | +Inquiry |
RFL18899HF | Recombinant Full Length Human Sodium Channel Subunit Beta-2(Scn2B) Protein, His-Tagged | +Inquiry |
SCN2B-2536H | Recombinant Human SCN2B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCN2B-1280HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
SCN2B-975HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCN2B Products
Required fields are marked with *
My Review for All SCN2B Products
Required fields are marked with *
0
Inquiry Basket