Recombinant Full Length Human S100A3 Protein, C-Flag-tagged
Cat.No. : | S100A3-1654HFL |
Product Overview : | Recombinant Full Length Human S100A3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.5 kDa |
AA Sequence : | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | S100A3 S100 calcium binding protein A3 [ Homo sapiens (human) ] |
Official Symbol | S100A3 |
Synonyms | S100E |
Gene ID | 6274 |
mRNA Refseq | NM_002960.2 |
Protein Refseq | NP_002951.1 |
MIM | 176992 |
UniProt ID | P33764 |
◆ Recombinant Proteins | ||
S100a3-6962M | Recombinant Mouse S100 Calcium Binding Protein A3, His-tagged | +Inquiry |
S100A3-2488H | Recombinant Human S100A3, GST-tagged | +Inquiry |
S100A3-1939H | Recombinant Human S100A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A3-1654HFL | Recombinant Full Length Human S100A3 Protein, C-Flag-tagged | +Inquiry |
S100A3-2113H | Recombinant Human S100A3 protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A3 Products
Required fields are marked with *
My Review for All S100A3 Products
Required fields are marked with *
0
Inquiry Basket