Recombinant Full Length Human RTRAF Protein, C-Flag-tagged

• Cat.No.: RTRAF-1955HFL
• Product Overview: Recombinant Full Length Human RTRAF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables RNA binding activity; RNA polymerase II complex binding activity; and identical protein binding activity. Involved in negative regulation of protein kinase activity; positive regulation of transcription by RNA polymerase II; and tRNA splicing, via endonucleolytic cleavage and ligation. Located in microtubule cytoskeleton; nucleoplasm; and perinuclear region of cytoplasm. Part of tRNA-splicing ligase complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 27.9 kDa
• AA Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: RTRAF RNA transcription, translation and transport factor [ Homo sapiens (human) ]
• Official Symbol: RTRAF
• Synonyms: C14orf166, CGI-99, CGI99, CLE, CLE7, LCRP369, RLLM1, hCLE, hCLE1
• Gene ID: 51637
• mRNA Refseq: NM_016039.3
• Protein Refseq: NP_057123
• MIM: 610858
• UniProt ID: Q9Y224