Recombinant Full Length Human RTL8C Protein, GST-tagged

• Cat.No.: RTL8C-2361HF
• Product Overview: Human CXX1 full-length ORF ( NP_001071639.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 113 amino acids
• Description: RTL8C (Retrotransposon Gag Like 8C) is a Protein Coding gene. An important paralog of this gene is RTL8A.
• Molecular Mass: 39.6 kDa
• AA Sequence: MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RTL8C retrotransposon Gag like 8C [ Homo sapiens (human) ]
• Official Symbol: RTL8C
• Synonyms: FAM127A; family with sequence similarity 127, member A; CAAX box 1 , CXX1; protein FAM127A; Mar8; MAR8C; Mart8; CAAX box 1; mammalian retrotransposon derived protein 8C; CXX1; MART8C; MGC117411
• Gene ID: 8933
• mRNA Refseq: NM_001078171
• Protein Refseq: NP_001071639
• MIM: 300213
• UniProt ID: A6ZKI3