Recombinant Full Length Human RRAS Protein, C-Flag-tagged
Cat.No. : | RRAS-2170HFL |
Product Overview : | Recombinant Full Length Human RRAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG GGCPCVLL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction |
Full Length : | Full L. |
Gene Name | RRAS RAS related [ Homo sapiens (human) ] |
Official Symbol | RRAS |
Synonyms | R-Ras |
Gene ID | 6237 |
mRNA Refseq | NM_006270.5 |
Protein Refseq | NP_006261.1 |
MIM | 165090 |
UniProt ID | P10301 |
◆ Recombinant Proteins | ||
RRAS-4839R | Recombinant Rat RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-1920H | Recombinant Human RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-2735H | Recombinant Human RRAS protein, His-tagged | +Inquiry |
RRAS-2360H | Recombinant Human RRAS, His-tagged | +Inquiry |
RRAS-3690H | Recombinant Human RRAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRAS Products
Required fields are marked with *
My Review for All RRAS Products
Required fields are marked with *
0
Inquiry Basket