Recombinant Full Length Human RRAS Protein, C-Flag-tagged

• Cat.No.: RRAS-2170HFL
• Product Overview: Recombinant Full Length Human RRAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 23.3 kDa
• AA Sequence: MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG GGCPCVLL myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
• Full Length: Full L.

Gene Information

• Gene Name: RRAS RAS related [ Homo sapiens (human) ]
• Official Symbol: RRAS
• Synonyms: R-Ras
• Gene ID: 6237
• mRNA Refseq: NM_006270.5
• Protein Refseq: NP_006261.1
• MIM: 165090
• UniProt ID: P10301