Recombinant Full Length Human RPL13AP17 Protein, GST-tagged

• Cat.No.: RPL13AP17-6396HF
• Product Overview: Human MGC34774 full-length ORF ( NP_976053.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 170 amino acids
• Description: RPL13AP17 (Ribosomal Protein L13a Pseudogene 17) is a Pseudogene.
• Molecular Mass: 44.9 kDa
• AA Sequence: MNSVSVVMMLTSKPLHILGRFITKPLLFTNSMENFELTPSRHGRVHHQSCHEAPRTYKVAAEDSRKTEPGAQWPRPSCGPPGSHLGQVGSAGKETGGRAPRGHQHFWQFLEKQIKVSGLPLQADEHQPFPRPARPAIPGPPAHLLVALQNQVGPGCPGPPYGVLWDLTAL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RPL13AP17 ribosomal protein L13a pseudogene 17 [ Homo sapiens (human) ]
• Official Symbol: RPL13AP17
• Synonyms: RPL13AP17; ribosomal protein L13a pseudogene 17; RPL13A_6_816
• Gene ID: 399670