Recombinant Full Length Human RNFT1 Protein, GST-tagged

• Cat.No.: RNFT1-5902HF
• Product Overview: Human LOC51136 full-length ORF ( AAH06971.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 208 amino acids
• Description: RNFT1 (Ring Finger Protein, Transmembrane 1) is a Protein Coding gene. Diseases associated with RNFT1 include Sertoli Cell-Only Syndrome. An important paralog of this gene is RNFT2.
• Molecular Mass: 49.6 kDa
• AA Sequence: MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHGSSSFSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRLNFFKSYFGPFELLGSILDCWNYRLHSEILFHGLKMPYFIGAFFHHAF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNFT1 ring finger protein, transmembrane 1 [ Homo sapiens ]
• Official Symbol: RNFT1
• Synonyms: RNFT1; ring finger protein, transmembrane 1; RING finger and transmembrane domain-containing protein 1; PTD016; MGC111090
• Gene ID: 51136
• mRNA Refseq: NM_016125
• Protein Refseq: NP_057209
• MIM: 615172
• UniProt ID: Q5M7Z0