Recombinant Full Length Human RNF113B Protein, C-Flag-tagged
Cat.No. : | RNF113B-2191HFL |
Product Overview : | Recombinant Full Length Human RNF113B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable metal ion binding activity. Predicted to be involved in snoRNA splicing. Predicted to be part of U2-type spliceosomal complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLH SWQKAAHGDRRGEEAAPESLDVVYRSTRSAKPVGPEDMGATADFEQDTEKEHHTPTILKCSQRVQEALRG REHDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQPDICKDYKETGFCGFGDS CKFLHDRSDYKLGWEIERELEEGRYCICEDENHEVGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCA LEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RNF113B ring finger protein 113B [ Homo sapiens (human) ] |
Official Symbol | RNF113B |
Synonyms | RNF161; ZNF183L1; bA10G5.1 |
Gene ID | 140432 |
mRNA Refseq | NM_178861.5 |
Protein Refseq | NP_849192.1 |
UniProt ID | Q8IZP6 |
◆ Recombinant Proteins | ||
RNF113B-0113H | Recombinant Human RNF113B Protein (A2-R322), Tag Free | +Inquiry |
RNF113B-0114H | Recombinant Human RNF113B Protein (A2-R322), His tagged | +Inquiry |
RNF113B-1896H | Recombinant Human RNF113B Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF113B-2191HFL | Recombinant Full Length Human RNF113B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF113B-2307HCL | Recombinant Human RNF113B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF113B Products
Required fields are marked with *
My Review for All RNF113B Products
Required fields are marked with *
0
Inquiry Basket