Recombinant Full Length Human RNASE2 Protein, GST-tagged

Cat.No. : RNASE2-6875HF
Product Overview : Human RNASE2 full-length ORF ( NP_002925.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 161 amino acids
Description : The protein encoded by this gene is a non-secretory ribonuclease that belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein antimicrobial activity against viruses.
Molecular Mass : 44.8 kDa
AA Sequence : MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNASE2 ribonuclease A family member 2 [ Homo sapiens (human) ]
Official Symbol RNASE2
Synonyms RNASE2; ribonuclease A family member 2; EDN; RAF3; RNS2; non-secretory ribonuclease; RNase 2; RNase UpI-2; eosinophil-derived neurotoxin; ribonuclease 2; ribonuclease A F3; ribonuclease US; ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); EC 4.6.1.18
Gene ID 6036
mRNA Refseq NM_002934
Protein Refseq NP_002925
MIM 131410
UniProt ID P10153

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RNASE2 Products

Required fields are marked with *

My Review for All RNASE2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon