Recombinant Full Length Human RMDN1 Protein, GST-tagged

• Cat.No.: RMDN1-4644HF
• Product Overview: Human FAM82B full-length ORF (1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 314 amino acids
• Description: RMDN1 (Regulator Of Microtubule Dynamics 1) is a Protein Coding gene. An important paralog of this gene is RMDN3.
• Molecular Mass: 62.2 kDa
• AA Sequence: MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQVISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYEESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RMDN1 regulator of microtubule dynamics 1 [ Homo sapiens (human) ]
• Official Symbol: RMDN1
• Synonyms: FAM82B; family with sequence similarity 82, member B; regulator of microtubule dynamics protein 1; CGI 90; FLJ20665; hRMD-1; microtubule-associated protein; regulator of microtubule dynamics 1; RMD1; RMD-1; CGI-90; RMDN1; regulator of microtubule dynamics 1
• Gene ID: 51115
• mRNA Refseq: NM_016033
• Protein Refseq: NP_057117
• MIM: 611871
• UniProt ID: Q96DB5