Recombinant Full Length Human Rhomboid Domain-Containing Protein 1(Rhbdd1) Protein, His-Tagged
Cat.No. : | RFL33643HF |
Product Overview : | Recombinant Full Length Human Rhomboid domain-containing protein 1(RHBDD1) Protein (Q8TEB9) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL LLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVEL VAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSS GYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS PEEMRRQRLHRFDSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RHBDD1 |
Synonyms | RHBDD1; RHBDL4; HSD-50; HSD50; Rhomboid-related protein 4; RRP4; Rhomboid domain-containing protein 1; Rhomboid-like protein 4 |
UniProt ID | Q8TEB9 |
◆ Recombinant Proteins | ||
RHBDD1-2285H | Recombinant Human RHBDD1, GST-tagged | +Inquiry |
RHBDD1-5026R | Recombinant Rat RHBDD1 Protein | +Inquiry |
RHBDD1-14154M | Recombinant Mouse RHBDD1 Protein | +Inquiry |
RFL33643HF | Recombinant Full Length Human Rhomboid Domain-Containing Protein 1(Rhbdd1) Protein, His-Tagged | +Inquiry |
RHBDD1-4685R | Recombinant Rat RHBDD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHBDD1-2365HCL | Recombinant Human RHBDD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHBDD1 Products
Required fields are marked with *
My Review for All RHBDD1 Products
Required fields are marked with *
0
Inquiry Basket