Recombinant Full Length Human RHNO1 Protein, GST-tagged

• Cat.No.: RHNO1-2024HF
• Product Overview: Human C12orf32 full-length ORF ( NP_113653.1, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 238 amino acids
• Description: Involved in cellular response to radiation; recombinational repair; and regulation of cell cycle process. Located in chromosome and nucleus.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 53.1 kDa
• AA Sequence: MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RHNO1 RAD9-HUS1-RAD1 interacting nuclear orphan 1 [ Homo sapiens (human) ]
• Official Symbol: RHNO1
• Synonyms: RHINO; C12orf32; HKMT1188
• Gene ID: 83695
• mRNA Refseq: NM_031465.2
• Protein Refseq: NP_113653.1
• MIM: 614085
• UniProt ID: Q9BSD3