Recombinant Full Length Human RFLNB Protein, GST-tagged

• Cat.No.: RFLNB-4449HF
• Product Overview: Human FAM101B full-length ORF ( NP_874364.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 214 amino acids
• Description: RFLNB (Refilin B) is a Protein Coding gene. An important paralog of this gene is RFLNA.
• Molecular Mass: 49.3 kDa
• AA Sequence: MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEPDAAAATPAAPSPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVPNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RFLNB refilin B [ Homo sapiens (human) ]
• Official Symbol: RFLNB
• Synonyms: RFLNB; refilin B; Refilin B; Family With Sequence Similarity 101, Member B; Regulator Of Filamin Protein B; RefilinB; Filamin-Interacting Protein FAM101B; Protein FAM101B; Refilin-B; FAM101B; CFM1; refilin-B; family with sequence similarity 101, member B; filamin-interacting protein FAM101B; protein FAM101B; refilinB; regulator of filamin protein B
• Gene ID: 359845
• mRNA Refseq: NM_182705
• Protein Refseq: NP_874364
• MIM: 615928
• UniProt ID: Q8N5W9