Recombinant Full Length Human Receptor-Transporting Protein 1(Rtp1) Protein, His-Tagged
Cat.No. : | RFL3931HF |
Product Overview : | Recombinant Full Length Human Receptor-transporting protein 1(RTP1) Protein (P59025) (1-263aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-263) |
Form : | Lyophilized powder |
AA Sequence : | MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RTP1 |
Synonyms | RTP1; Z3CXXC1; Receptor-transporting protein 1; 3CxxC-type zinc finger protein 1 |
UniProt ID | P59025 |
◆ Recombinant Proteins | ||
RTP1-636C | Recombinant Cynomolgus Monkey RTP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTP1-2465H | Recombinant Human RTP1, GST-tagged | +Inquiry |
RTP1-7854H | Recombinant Human RTP1 protein, His-tagged | +Inquiry |
RFL3931HF | Recombinant Full Length Human Receptor-Transporting Protein 1(Rtp1) Protein, His-Tagged | +Inquiry |
RTP1-7855H | Recombinant Human RTP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTP1-2118HCL | Recombinant Human RTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTP1 Products
Required fields are marked with *
My Review for All RTP1 Products
Required fields are marked with *
0
Inquiry Basket