Recombinant Full Length Human Ras-related C3 Botulinum Toxin Substrate 1 / RAC1 Protein, Untagged
Cat.No. : | RAC1-189H |
Product Overview : | Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 produced inE.Coliis a single, non-glycosylated polypeptide chain. The protein contains 192 amino acids and has a molecular mass of 21.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-192 a.a. |
Description : | RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion. |
Amino Acid Sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL. |
Physical Appearance : | Sterile Filtered colorless solution. |
Formulation : | The protein solution (1mg/ml) cotains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. |
Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Stability : | RAC1 although stable 14°Cfor 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | RAC1 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [ Homo sapiens ] |
Synonyms | RAC1; MGC111543; MIG5; TC-25; PAK1; TC25; P21-RAC1; RAC-1; p21-Rac1;Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); RAS-like protein; Ras-related C3 botulinum toxin substrate 1; rho family; small GTP binding protein Rac1; Ras-related C3 botulinum toxin substrate 1; Cell migration-inducing gene 5 protein; Ras-like protein TC25; migration-inducing gene 5; migration-inducing protein 5; ras-related C3 botulinum toxin substrate 1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1 isoform Rac1; ras-related C3 botulinum toxin substrate 1 isoform Rac1b; rho family, small GTP binding protein Rac1 |
Gene ID | 5879 |
mRNA Refseq | NM_006908 |
Protein Refseq | NP_008839 |
MIM | 602048 |
UniProt ID | P63000 |
Chromosome Location | 7p22 |
Pathway | Adherens junction; Amyotrophic lateral sclerosis (ALS); Axon guidance; B cell receptor signaling pathway; Chemokine signaling pathway; Colorectal cancer; Epithelial cell signaling in Helicobacter pylori infection; Fc epsilon RI signaling pathway; Fc gamma R-mediated phagocytosis; Focal adhesion; Leukocyte transendothelial migration; MAPK signaling pathway; Natural killer cell mediated cytotoxicity; Neurotrophin signaling pathway; Pancreatic cancer; Regulation of actin cytoskeleton; Renal cell carcinoma; Toll-like receptor signaling pathway; VEGF signaling pathway; Wnt signaling pathway |
Function | GTP binding; GTP-dependent protein binding; GTPase activity; enzyme binding; nucleotide binding |
◆ Recombinant Proteins | ||
RAC1-4567R | Recombinant Rat RAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAC1-190H | Active Recombinant Human RAC1, His-tagged | +Inquiry |
RAC1-194H | Recombinant Full Length Human RAC1 protein, His-tagged | +Inquiry |
RAC1-1105HFL | Recombinant Full Length Human RAC1 Protein, C-Flag-tagged | +Inquiry |
RAC1-189H | Recombinant Full Length Human Ras-related C3 Botulinum Toxin Substrate 1 / RAC1 Protein, Untagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAC1-712HCL | Recombinant Human RAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAC1 Products
Required fields are marked with *
My Review for All RAC1 Products
Required fields are marked with *
0
Inquiry Basket