Recombinant Full Length Human RAC1 protein, His-tagged

• Cat.No.: RAC1-194H
• Product Overview: Recombinant Human RAC1 fused with His tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: His
• Form: 20 mM Tris-HCl, 0.15 M NaCl, pH8.0
• AA Sequence: GSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSA NVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTK LDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLL L
• Endotoxin: <1eu/ug as determined by the LAL method
• Purity: ~ 90% by SDS-PAGE analysis
• Storage: For long term storage, prepare aliquots and store at -20 centigrade. Avoid freeze/thaw cycles.
• Protein length: 1-192 a.a.

Gene Information

• Gene Name: RAC1 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [ Homo sapiens ]
• Official Symbol: RAC1
• Synonyms: RAC1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1; p21 Rac1; Rac 1; TC 25; ras-like protein TC25; cell migration-inducing gene 5 protein; MIG5; Rac-1; TC-25; p21-Rac1; MGC111543
• Gene ID: 5879
• mRNA Refseq: NM_006908
• Protein Refseq: NP_008839
• MIM: 602048
• UniProt ID: P63000
• Chromosome Location: 7p22
• Pathway: Activation of Rac, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem
• Function: GTP binding; GTPase activity; enzyme binding; nucleotide binding; protein binding; thioesterase binding