Recombinant Full Length Human RAB37 Protein, C-Flag-tagged
Cat.No. : | RAB37-2160HFL |
Product Overview : | Recombinant Full Length Human RAB37 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNK VVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIML LGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYV ESQKKRSSCCSFM myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | RAB37 RAB37, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB37 |
Synonyms | FLJ30284; FLJ32507 |
Gene ID | 326624 |
mRNA Refseq | NM_001006638.3 |
Protein Refseq | NP_001006639.1 |
MIM | 609956 |
UniProt ID | Q96AX2 |
◆ Recombinant Proteins | ||
RAB37-5848H | Recombinant Human RAB37 Protein (Ser19-Cys220), N-His tagged | +Inquiry |
RAB37-1833H | Recombinant Human RAB37 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB37-3749R | Recombinant Rhesus monkey RAB37 Protein, His-tagged | +Inquiry |
RAB37-2160HFL | Recombinant Full Length Human RAB37 Protein, C-Flag-tagged | +Inquiry |
Rab37-5313M | Recombinant Mouse Rab37 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB37-2602HCL | Recombinant Human RAB37 293 Cell Lysate | +Inquiry |
RAB37-2601HCL | Recombinant Human RAB37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB37 Products
Required fields are marked with *
My Review for All RAB37 Products
Required fields are marked with *
0
Inquiry Basket