Recombinant Full Length Human RAB10 Protein, C-Flag-tagged

• Cat.No.: RAB10-119HFL
• Product Overview: Recombinant Full Length Human RAB10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: RAB10 belongs to the RAS superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 22.4 kDa
• AA Sequence: MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI
  AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: RAB10 RAB10, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB10
• Synonyms: Ac1075; RAB10, member RAS oncogene family; ras-related protein rab10
• Gene ID: 10890
• mRNA Refseq: NM_016131.5
• Protein Refseq: NP_057215.3
• MIM: 612672
• UniProt ID: P61026

Q&As

Did you check the phosphorylation status of the produced protéin?

We didn't check the phosphorylation status of our RAB10 proteins. But the following one expressed in HEK293 should be phosphorylated. RAB10-119HFL