Recombinant Full Length Human R spondin 3 Protein, His tagged

• Cat.No.: RSPO3-423H
• Product Overview: Recombinant Full Length Human R spondin 3 Protein with His tag was expressed in HEK293.

Specification

• Description: This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
• Source: HEK293
• Species: Human
• Tag: C-His
• Protein length: 22-272 aa
• Molecular Mass: 29.45kDa
• AA Sequence: QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVHHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: ≥ 95% by SDS-PAGE
• Storage: Store it at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. Stable for at least 1 year from receipt of products under proper storage and handling conditions
• Storage Buffer: PBS (pH 7.4), 5% trehalose
• Concentration: 1 mg/mL

Gene Information

• Gene Name: RSPO3 R-spondin 3 [ Homo sapiens (human) ]
• Official Symbol: RSPO3
• Synonyms: RSPO3; R-spondin 3; PWTSR; THSD2; CRISTIN1; R-spondin-3 R-spondin 3 homolog protein with TSP type-1 repeat roof plate-specific spondin-3 thrombospondin type-1 domain-containing protein 2 thrombospondin, type I, domain containing 2
• Gene ID: 84870
• mRNA Refseq: NM_032784
• Protein Refseq: NP_116173
• MIM: 610574
• UniProt ID: Q9BXY4