Recombinant Human RSPO3 Protein, Fc/His-tagged

• Cat.No.: RSPO3-441H
• Product Overview: Recombinant Human RSPO3 fused with Fc/His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Description: This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 56.3kD
• AA Sequence: QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: RSPO3 R-spondin 3 [ Homo sapiens ]
• Official Symbol: RSPO3
• Synonyms: RSPO3; R-spondin 3; R spondin 3 homolog (Xenopus laevis) , thrombospondin, type I, domain containing 2 , THSD2; R-spondin-3; FLJ14440; R-spondin 3 homolog; roof plate-specific spondin-3; protein with TSP type-1 repeat; thrombospondin, type I, domain containing 2; thrombospondin type-1 domain-containing protein 2; PWTSR; THSD2; CRISTIN1
• Gene ID: 84870
• mRNA Refseq: NM_032784
• Protein Refseq: NP_116173
• MIM: 610574
• UniProt ID: Q9BXY4