Recombinant Full Length Human PYY Protein
| Cat.No. : | PYY-417HF |
| Product Overview : | Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 36.740kDa inclusive of tags |
| Protein length : | 97 amino acids |
| AA Sequence : | MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PYY peptide YY [ Homo sapiens ] |
| Official Symbol | PYY |
| Synonyms | PYY; peptide YY; PYY1 |
| Gene ID | 5697 |
| mRNA Refseq | NM_004160 |
| Protein Refseq | NP_004151 |
| MIM | 606838 |
| UniProt ID | P10082 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *
0
Inquiry Basket
