Recombinant Full Length Human PYCR1 Protein, C-Flag-tagged

• Cat.No.: PYCR1-1476HFL
• Product Overview: Recombinant Full Length Human PYCR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 33.2 kDa
• AA Sequence: MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA
  AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways
• Full Length: Full L.

Gene Information

• Gene Name: PYCR1 pyrroline-5-carboxylate reductase 1 [ Homo sapiens (human) ]
• Official Symbol: PYCR1
• Synonyms: P5C; P5CR; PRO3; PYCR; PIG45; PP222; ARCL2B; ARCL3B
• Gene ID: 5831
• mRNA Refseq: NM_006907.4
• Protein Refseq: NP_008838.2
• MIM: 179035
• UniProt ID: P32322