Recombinant Full Length Human Putative Uncharacterized Protein Encoded By Linc00116(Linc00116) Protein, His-Tagged
Cat.No. : | RFL8315HF |
Product Overview : | Recombinant Full Length Human Putative uncharacterized protein encoded by LINC00116(LINC00116) Protein (Q8NCU8) (1-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-138) |
Form : | Lyophilized powder |
AA Sequence : | MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPP LNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWR KRRLQDKLAATQKKLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMIM37 |
Synonyms | MTLN; LEMP; LINC00116; MOXI; MPM; NCRNA00116; SMIM37; Mitoregulin; Micropeptide in mitochondria; Micropeptide regulator of beta-oxidation; Small integral membrane protein 37; lncRNA-encoded micropeptide |
UniProt ID | Q8NCU8 |
◆ Recombinant Proteins | ||
PKD1L3-12859M | Recombinant Mouse PKD1L3 Protein | +Inquiry |
Ctla4-1143RF | Recombinant Rat Ctla4 Protein, hFc-tagged, FITC conjugated | +Inquiry |
CHUK-3422HF | Active Recombinant Full Length Human CHUK Protein, GST-tagged | +Inquiry |
SYCP3-995C | Recombinant Cynomolgus SYCP3 Protein, His-tagged | +Inquiry |
ATAD3A-3763B | Recombinant Bovine ATAD3A, His-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
Hp1-1-195H | Native Human Haptoglobin 1-1 | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO2-5710HCL | Recombinant Human GSTO2 293 Cell Lysate | +Inquiry |
HN1L-5462HCL | Recombinant Human HN1L 293 Cell Lysate | +Inquiry |
CASQ2-7826HCL | Recombinant Human CASQ2 293 Cell Lysate | +Inquiry |
CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
Spleen-865R | Mini Rabbit Spleen Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMIM37 Products
Required fields are marked with *
My Review for All SMIM37 Products
Required fields are marked with *
0
Inquiry Basket