Recombinant Full Length Human PUDP Protein, GST-tagged

• Cat.No.: PUDP-3442HF
• Product Overview: Human HDHD1A full-length ORF ( NP_036212.2, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 214 amino acids
• Description: This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]
• Molecular Mass: 50.1 kDa
• AA Sequence: MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PUDP pseudouridine 5'-phosphatase [ Homo sapiens (human) ]
• Official Symbol: PUDP
• Synonyms: PUDP; pseudouridine 5'-phosphatase; GS1; HDHD1; HDHD1A; FAM16AX; DXF68S1E; pseudouridine-5'-phosphatase; 5'-PsiMPase; family with sequence similarity 16, member A, X-linked; haloacid dehalogenase-like hydrolase domain containing 1; haloacid dehalogenase-like hydrolase domain containing 1A; haloacid dehalogenase-like hydrolase domain-containing protein 1; haloacid dehalogenase-like hydrolase domain-containing protein 1A; pseudouridine-5'-monophosphatase; EC 3.1.3.96
• Gene ID: 8226
• mRNA Refseq: NM_001135565
• Protein Refseq: NP_001129037
• MIM: 306480
• UniProt ID: Q08623