Recombinant Full Length Human PSPH protein, GST-tagged
Cat.No. : | PSPH-3385H |
Product Overview : | Recombinant Human PSPH protein(P78330)(1-225aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-225aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52 kDa |
AA Sequence : | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PSPH phosphoserine phosphatase [ Homo sapiens ] |
Official Symbol | PSPH |
Synonyms | PSPH; phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; PSPHD; |
Gene ID | 5723 |
mRNA Refseq | NM_004577 |
Protein Refseq | NP_004568 |
MIM | 172480 |
UniProt ID | P78330 |
◆ Recombinant Proteins | ||
PSPH-198H | Recombinant Full Length Human Phosphoserine Phosphatase / PSPH Protein, Untagged | +Inquiry |
PSPH-3385Z | Recombinant Zebrafish PSPH | +Inquiry |
PSPH-4792R | Recombinant Rat PSPH Protein | +Inquiry |
PSPH-4451R | Recombinant Rat PSPH Protein, His (Fc)-Avi-tagged | +Inquiry |
PSPH-3385H | Recombinant Full Length Human PSPH protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSPH-1430HCL | Recombinant Human PSPH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSPH Products
Required fields are marked with *
My Review for All PSPH Products
Required fields are marked with *
0
Inquiry Basket